PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00100652001
Common NameGSBRNA2T00100652001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 229aa    MW: 25312.2 Da    PI: 7.3363
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00100652001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.25.1e-42701691100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+C ++Cvlapyfp ++p+kf ++h++FGasn++kll++lpe++r+da++s+vyeA ar+rdP+yG++g i +lq+q+++l
  GSBRNA2T00100652001  70 PCAACKILRRRCGDKCVLAPYFPPTEPAKFTIAHRVFGASNIIKLLQELPESQRTDAVNSMVYEAGARIRDPIYGCAGAIYNLQRQVSEL 159
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +a+la+++ e
  GSBRNA2T00100652001 160 QAQLAKAQVE 169
                          *****99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.97369170IPR004883Lateral organ boundaries, LOB
PfamPF031958.2E-4270167IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MASFMMSAGS PHFVYNSIYT TYLPKSTSPS KQLIMLDMES KCDASAAIIS ASPTSSPPPP  60
QLSPRLVLSP CAACKILRRR CGDKCVLAPY FPPTEPAKFT IAHRVFGASN IIKLLQELPE  120
SQRTDAVNSM VYEAGARIRD PIYGCAGAIY NLQRQVSELQ AQLAKAQVEI VSMQLQRSNL  180
LELIHNMDQP NQELHNMSFD KSNDFGLPDD IKYTNTIPST LWCDPLWI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00100652001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013711225.11e-151PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR04e-96LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A078E0I71e-171A0A078E0I7_BRANA; BnaC05g05560D protein
STRINGBra018675.1-P1e-118(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-89LOB domain-containing protein 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]